PDB entry 1gdj

View 1gdj on RCSB PDB site
Description: crystal structure of ferric complexes of the yellow lupin leghemoglobin with isoquinoline at 1.8 angstroms resolution (russian)
Deposited on 1994-09-14, released 1995-02-27
The last revision prior to the SCOP 1.63 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1gdj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gdj_ (-)
    galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
    qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
    vvgakwseelnsawtiaydelaivikkemddaa