PDB entry 1gdi

View 1gdi on RCSB PDB site
Description: crystal structure of ferric complexes of the yellow lupin leghemoglobin with isoquinoline at 1.8 angstroms resolution (russian)
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1994-09-14, released 1995-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leghemoglobin (carbonmonoxy)
    Species: Lupinus luteus [TaxId:3873]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02240 (0-152)
      • conflict (78)
      • conflict (149)
    Domains in SCOPe 2.08: d1gdia_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gdiA (A:)
    galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
    qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
    vvgakwseelnsawtiaydelaivikkemddaa