PDB entry 1gdd

View 1gdd on RCSB PDB site
Description: tertiary and quaternary structural changes in gia1 induced by gtp hydrolysis
Deposited on 1995-07-25, released 1995-11-27
The last revision prior to the SCOP 1.55 freeze date was dated 1995-11-27, with a file datestamp of 1995-11-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1gdd_ (-)
    dkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagyseeeckq
    ykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmtaelagvik
    rlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkttgiveth
    ftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmk
    lfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfe
    dlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gdd_ (-)
    dkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagyseeeckq
    ykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmtaelagvik
    rlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkttgiveth
    ftfkdlhfkmfdvvtaiifcvalsdydlvmnrmhesmklfdsicnnkwftdtsiilflnk
    kdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtk
    nvqfvfdavtdviiknnlkdcglf