PDB entry 1gd7

View 1gd7 on RCSB PDB site
Description: crystal structure of a bifunctional protein (csaa) with export-related chaperone and tRNA-binding activities.
Class: RNA binding protein
Keywords: OLIGONUCLEOTIDE-BINDING FOLD, FUNCTIONAL DIMER, HYDROPHOBIC CAVITY, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA BINDING PROTEIN
Deposited on 2000-09-22, released 2001-09-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: csaa protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1gd7a_
  • Chain 'B':
    Compound: csaa protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1gd7b_
  • Chain 'C':
    Compound: csaa protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1gd7c_
  • Chain 'D':
    Compound: csaa protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1gd7d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd7A (A:)
    mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvg
    rlvvcavnlgakrvagflsevlvlgvpdeagrvvllapdrevplggkvf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd7B (B:)
    mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvg
    rlvvcavnlgakrvagflsevlvlgvpdeagrvvllapdrevplggkvf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd7C (C:)
    mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvg
    rlvvcavnlgakrvagflsevlvlgvpdeagrvvllapdrevplggkvf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd7D (D:)
    mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvg
    rlvvcavnlgakrvagflsevlvlgvpdeagrvvllapdrevplggkvf