PDB entry 1gd6

View 1gd6 on RCSB PDB site
Description: structure of the bombyx mori lysozyme
Class: hydrolase
Keywords: lysozyme, 1,4-beta-n-acetylmuramidase, bmlz
Deposited on 2000-09-19, released 2001-03-21
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Bombyx mori
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gd6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gd6A (A:)
    ktftrcglvhelrkhgfeenlmrnwvclvehessrdtsktntnrngskdyglfqindryw
    cskgaspgkdcnvkcsdlltdditkaakcakkiykrhrfdawygwknhcqgslpdissc