PDB entry 1gcx

View 1gcx on RCSB PDB site
Description: crystal structure of family b dna polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis kod1
Deposited on 2000-08-11, released 2001-02-28
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-28, with a file datestamp of 2001-02-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gcxA (A:)
    mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
    tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
    lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
    vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
    tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrsstgnlvewfllrk
    ayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkmkatidpierklld
    yrqraikilansyygyygyararwyckecaesvtawgreyitmtikeieekygfkviysd
    tdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgffvtkkkyavidee
    gkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevteklskyevppekl
    viheqitrdlkdykatgphvavakrlaargvkirpgtvisyivlkgsgrigdraipfdef
    dptkhkydaeyyienqvlpaverilrafgyrkedlryq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcxA (A:)
    mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
    tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
    lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
    vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
    tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrsstgnlvewfllrk
    ayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkmkatidpierklld
    yrqraikilansyygyygyararwyckecaesvtawgreyitmtikeieekygfkviysd
    tdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgffvtkkkyavidee
    gkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevteklskyevppekl
    viheqiphvavakrlaatvisyivlraipfdefdptkhkydaeyyienqvlpaverilrg
    yrkedlryq