PDB entry 1gcw

View 1gcw on RCSB PDB site
Description: co form hemoglobin from mustelus griseus
Class: oxygen storage/transport
Keywords: hemoglobin, carbon monoxide bound form
Deposited on 2000-08-08, released 2000-09-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemoglobin)
    Species: Mustelus griseus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gcwa_
  • Chain 'B':
    Compound: protein (hemoglobin)
    Species: Mustelus griseus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gcwb_
  • Chain 'C':
    Compound: protein (hemoglobin)
    Species: Mustelus griseus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gcwc_
  • Chain 'D':
    Compound: protein (hemoglobin)
    Species: Mustelus griseus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gcwd_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcwA (A:)
    aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg
    kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt
    hcavdkllsaicqelssryr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gcwB (B:)
    vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga
    lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw
    dkffevvidaiskqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcwB (B:)
    vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqfrssihagivvgalqda
    vkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiwdkff
    evvidaisk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcwC (C:)
    aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg
    kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt
    hcavdkllsaicqelssryr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gcwD (D:)
    vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga
    lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw
    dkffevvidaiskqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcwD (D:)
    vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqfrssihagivvgalqda
    vkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiwdkff
    evvidaisk