PDB entry 1gce

View 1gce on RCSB PDB site
Description: structure of the beta-lactamase of enterobacter cloacae gc1
Class: hydrolase
Keywords: beta-lactam hydrolase, cephalosporinase, drug design, extended-spectrum beta- lactamase, hydrolase
Deposited on 1999-05-17, released 1999-08-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1gcea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gceA (A:)
    tpvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
    elgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplq
    vpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlk
    plkldhtwinvpkaeeahyawgyrdgkavravrvspgmldaqaygvktnvqdmanwvman
    mapenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplp
    vaevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhil
    ealq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gceA (A:)
    tpvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
    elgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplq
    vpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlk
    plkldhtwinvpkaeeahyawgyrdgkavravrpgmldaqaygvktnvqdmanwvmanma
    penvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpva
    evnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhilea
    lq