PDB entry 1gbw

View 1gbw on RCSB PDB site
Description: crystal structure of mutant human lysozyme substituted at the surface positions
Deposited on 2000-06-26, released 2000-07-27
The last revision prior to the SCOP 1.59 freeze date was dated 2000-07-27, with a file datestamp of 2000-07-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.163
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1gbwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gbwA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawiawrnrcqnrd
    vrqyvqgcgv