PDB entry 1gbs

View 1gbs on RCSB PDB site
Description: crystal structure of black swan goose-type lysozyme at 1.8 angstroms resolution
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-03-15, released 1995-07-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.184
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: australian black swan egg white lysozyme
    Species: Cygnus atratus [TaxId:8868]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1gbsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gbsA (A:)
rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
kqhgy