PDB entry 1gbs

View 1gbs on RCSB PDB site
Description: crystal structure of black swan goose-type lysozyme at 1.8 angstroms resolution
Deposited on 1995-03-15, released 1995-07-10
The last revision prior to the SCOP 1.69 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1gbs__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gbs_ (-)
    rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
    vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
    tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
    kqhgy