PDB entry 1gbr

View 1gbr on RCSB PDB site
Description: orientation of peptide fragments from sos proteins bound to the n-terminal sh3 domain of grb2 determined by nmr spectroscopy
Class: signal transduction protein
Keywords: signal transduction protein
Deposited on 1994-08-12, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE GRB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60631 (9-69)
      • conflict (68)
    Domains in SCOPe 2.08: d1gbra1, d1gbra2, d1gbra3
  • Chain 'B':
    Compound: sos-a peptide
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gbrA (A:)
gsrrasvgsmeaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipkn
yiemkphpefivtd

  • Chain 'B':
    No sequence available.