PDB entry 1gbq

View 1gbq on RCSB PDB site
Description: solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Class: complex (signal transduction/peptide)
Keywords: complex (signal transduction/peptide), sh3 domain
Deposited on 1996-12-23, released 1997-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: grb2
    Species: Mus musculus [TaxId:10090]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gbqa_
  • Chain 'B':
    Compound: sos-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1gbqA (A:)
gsrrasvgsmeaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipkn
yiemkphpefivtd

    Sequence, based on observed residues (ATOM records): (download) 
    >1gbqA (A:)
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemkp

  • Chain 'B':
    No sequence available.