PDB entry 1gb4

View 1gb4 on RCSB PDB site
Description: hyperthermophilic variant of the b1 domain from streptococcal protein g, nmr, 47 structures
Deposited on 1998-01-19, released 1998-07-22
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-22, with a file datestamp of 1998-07-22.
Experiment type: NMR47
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1gb4__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gb4_ (-)
    mttfkliingktlkgeitieavdaaeaekifkqyandngidgewtyddatktftvte