PDB entry 1gaw

View 1gaw on RCSB PDB site
Description: crystal structure analysis of the ferredoxin-nadp+ reductase from maize leaf
Deposited on 2000-05-17, released 2001-02-07
The last revision prior to the SCOP 1.63 freeze date was dated 2001-02-07, with a file datestamp of 2001-02-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gawA (A:)
    patakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipy
    regqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkg
    vcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekhd
    dykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqtr
    maeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqwn
    vevy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gawB (B:)
    apatakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkip
    yregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivk
    gvcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekh
    ddykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqt
    rmaeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqw
    nvevy