PDB entry 1gaw

View 1gaw on RCSB PDB site
Description: crystal structure analysis of the ferredoxin-nadp+ reductase from maize leaf
Class: oxidoreductase/electron transport
Keywords: oxidoreductase/electron transport
Deposited on 2000-05-17, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp+ reductase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gawa1, d1gawa2
  • Chain 'B':
    Compound: ferredoxin-nadp+ reductase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gawb1, d1gawb2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gawA (A:)
    iraqasaveapatakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhm
    vfstegkipyregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliy
    tndageivkgvcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsf
    lwkmffekhddykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtna
    agermyiqtrmaeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdyk
    kqlkrgdqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gawA (A:)
    patakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipy
    regqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkg
    vcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekhd
    dykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqtr
    maeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqwn
    vevy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gawB (B:)
    iraqasaveapatakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhm
    vfstegkipyregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliy
    tndageivkgvcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsf
    lwkmffekhddykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtna
    agermyiqtrmaeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdyk
    kqlkrgdqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gawB (B:)
    apatakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkip
    yregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivk
    gvcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekh
    ddykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqt
    rmaeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqw
    nvevy