PDB entry 1gam

View 1gam on RCSB PDB site
Description: gamma b crystallin truncated c-terminal domain
Class: eye-lens protein
Keywords: gamma crystallin b, eye lens protein, multigene family, eye-lens protein
Deposited on 1996-02-02, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma b crystallin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02526 (0-85)
      • conflict (20)
    Domains in SCOPe 2.08: d1gama_
  • Chain 'B':
    Compound: gamma b crystallin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02526 (0-85)
      • conflict (20)
    Domains in SCOPe 2.08: d1gamb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gamA (A:)
tfrmriyerddfrgqmseitadcpslqdrfhltevhslnvlegswvlyempsyrgrqyll
rpgeyrryldwgamnakvgslrrvmd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gamB (B:)
tfrmriyerddfrgqmseitadcpslqdrfhltevhslnvlegswvlyempsyrgrqyll
rpgeyrryldwgamnakvgslrrvmd