PDB entry 1ga0

View 1ga0 on RCSB PDB site
Description: structure of the e. cloacae gc1 beta-lactamase with a cephalosporin sulfone inhibitor
Class: hydrolase
Keywords: mixed alpha/beta, cephalosporinase, inhibition, conformational change, class C beta-lactamase, HYDROLASE
Deposited on 2000-11-28, released 2001-06-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: BLAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ga0a_
  • Heterogens: NA, DVR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ga0A (A:)
    tpvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
    elgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplq
    vpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlk
    plkldhtwinvpkaeeahyawgyrdgkavravrvspgmldaqaygvktnvqdmanwvman
    mapenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplp
    vaevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhil
    ealq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ga0A (A:)
    pvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
    lgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqv
    pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
    lkldhtwinvpkaeeahyawgyrdgkavravrvspgmldaqaygvktnvqdmanwvmanm
    apenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpv
    aevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhile
    alq