PDB entry 1g8s

View 1g8s on RCSB PDB site
Description: methanococcus jannaschii fibrillarin pre-rRNA processing protein
Class: RNA binding protein
Keywords: rRNA processing; RNA binding, RNA BINDING PROTEIN
Deposited on 2000-11-20, released 2003-10-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillarin-like pre-rRNA processing protein
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: 0697
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1g8sa_
  • Heterogens: MET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8sA (A:)
    medikikeifeniyevdlgdglkriatksivkgkkvydekiikigdeeyriwnpnkskla
    aaiikglkvmpikrdskilylgasagttpshvadiadkgivyaieyaprimrelldacae
    reniipilgdankpqeyanivekvdviyedvaqpnqaeiliknakwflkkggygmiaika
    rsidvtkdpkeifkeqkeileaggfkivdevdiepfekdhvmfvgiwegk