PDB entry 1g8m

View 1g8m on RCSB PDB site
Description: crystal structure of avian atic, a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis at 1.75 ang. resolution
Deposited on 2000-11-17, released 2001-04-27
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-27, with a file datestamp of 2001-04-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.2
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8mA (A:)
    rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
    grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
    kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
    aqydaaisdyfrkeyskgvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcd
    alnawqlvkelkqalgipaaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasa
    yarsrgadrmssfgdfialsdicdvptakiisrevsdgvvapgyeeealkilskkknggy
    cvlqmdpnyepddneirtlyglqlmqkrnnavidrslfknivtknktlpesavrdlivas
    iavkytqsnsvcyakdgqvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagv
    kraevsnaidqyvtgtigededlvkwqamfeevpaqlteaekkqwiakltavslssdaff
    pfrdnvdrakrigvqfivapsgsaadevvieacnelgitlihtnlrlfhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8mB (B:)
    rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
    grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
    kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
    aqydaaisdyfrkeyskgvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcd
    alnawqlvkelkqalgipaaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasa
    yarsrgadrmssfgdfialsdicdvptakiisrevsdgvvapgyeeealkilskkknggy
    cvlqmdpnyepddneirtlyglqlmqkrnnavidrslfknivtknktlpesavrdlivas
    iavkytqsnsvcyakdgqvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagv
    kraevsnaidqyvtgtigededlvkwqamfeevpaqlteaekkqwiakltavslssdaff
    pfrdnvdrakrigvqfivapsgsaadevvieacnelgitlihtnlrlfhh