PDB entry 1g8k

View 1g8k on RCSB PDB site
Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis
Deposited on 2000-11-17, released 2000-12-13
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-13, with a file datestamp of .
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.154
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kA (A:)
    ndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplav
    tltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsap
    rlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtgklm
    fsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyf
    lnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiep
    gtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkra
    aewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmggh
    qegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqa
    mqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmng
    errirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafn
    dgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyte
    gkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqery
    pmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgd
    vttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kB (B:)
    rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
    thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
    vdgliygrqanvi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kC (C:)
    ndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplav
    tltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsap
    rlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtgklm
    fsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyf
    lnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiep
    gtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkra
    aewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmggh
    qegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqa
    mqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmng
    errirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafn
    dgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyte
    gkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqery
    pmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgd
    vttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kD (D:)
    rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
    thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
    vdgliygrqanvi
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kE (E:)
    ndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplav
    tltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsap
    rlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtgklm
    fsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyf
    lnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiep
    gtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkra
    aewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmggh
    qegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqa
    mqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmng
    errirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafn
    dgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyte
    gkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqery
    pmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgd
    vttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kF (F:)
    rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
    thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
    vdgliygrqanvi
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kG (G:)
    ndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplav
    tltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsap
    rlyaadewvdttwdhamalyaglikktldkdgpqgvffscfdhggagggfentwgtgklm
    fsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyf
    lnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiep
    gtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkra
    aewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmggh
    qegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqa
    mqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmng
    errirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafn
    dgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyte
    gkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqery
    pmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgd
    vttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8kH (H:)
    rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
    thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
    vdgliygrqanvi