PDB entry 1g8j

View 1g8j on RCSB PDB site
Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis
Class: oxidoreductase
Keywords: OXIDASE, ARSENITE, MOLYBDOPTERIN, [3Fe-4S] CLUSTER, [2Fe-2S] CLUSTER, RIESKE, OXIDOREDUCTASE
Deposited on 2000-11-17, released 2000-12-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.193
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1g8ja1, d1g8ja2
  • Chain 'B':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1g8jb_
  • Chain 'C':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1g8jc1, d1g8jc2
  • Chain 'D':
    Compound: arsenite oxidase
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1g8jd_
  • Heterogens: MGD, O, 4MO, F3S, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g8jA (A:)
    gcpndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpp
    lastltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerl
    saprlyaadewvdttwdhamalyaglikktldsdgpqgvffscfdhggagggfentwgtg
    klmfsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqt
    nyflnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhla
    iepgtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdml
    kraaewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrm
    gghqegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaiv
    kqamqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnlts
    mngerrirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteed
    afndgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgteml
    ytegkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmq
    erypmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngi
    qgdvttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8jA (A:)
    ritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplastl
    tpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsaprl
    yaadewvdttwdhamalyaglikktldsdgpqgvffscfdhggagggfentwgtgklmfs
    aiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyfln
    hwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiepgt
    dtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkraae
    wsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmgghqe
    gytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqamq
    kargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmnger
    rirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafndg
    frragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlytegk
    fdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypm
    ayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvt
    tdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g8jB (B:)
    rttlaypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlc
    thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
    vdgliygrqanvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8jB (B:)
    ypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlcthmgc
    ptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavgvdgli
    ygrqanvi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g8jC (C:)
    gcpndritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpp
    lastltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerl
    saprlyaadewvdttwdhamalyaglikktldsdgpqgvffscfdhggagggfentwgtg
    klmfsaiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqt
    nyflnhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhla
    iepgtdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdml
    kraaewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrm
    gghqegytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaiv
    kqamqkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnlts
    mngerrirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteed
    afndgfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgteml
    ytegkfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmq
    erypmayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngi
    qgdvttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8jC (C:)
    dritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplast
    ltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsapr
    lyaadewvdttwdhamalyaglikktldsdgpqgvffscfdhggagggfentwgtgklmf
    saiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyfl
    nhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiepg
    tdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkraa
    ewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmgghq
    egytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqam
    qkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmnge
    rrirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafnd
    gfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyteg
    kfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqeryp
    mayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdv
    ttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g8jD (D:)
    rttlaypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlc
    thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
    vdgliygrqanvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g8jD (D:)
    aypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlcthmg
    cptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavgvdgl
    iygrqanvi