PDB entry 1g8j

View 1g8j on RCSB PDB site
Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis
Deposited on 2000-11-17, released 2000-12-13
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-13, with a file datestamp of .
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.193
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8jA (A:)
    ritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplastl
    tpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsaprl
    yaadewvdttwdhamalyaglikktldsdgpqgvffscfdhggagggfentwgtgklmfs
    aiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyfln
    hwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiepgt
    dtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkraae
    wsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmgghqe
    gytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqamq
    kargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmnger
    rirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafndg
    frragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlytegk
    fdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypm
    ayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvt
    tdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8jB (B:)
    ypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlcthmgc
    ptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavgvdgli
    ygrqanvi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8jC (C:)
    dritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplast
    ltpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsapr
    lyaadewvdttwdhamalyaglikktldsdgpqgvffscfdhggagggfentwgtgklmf
    saiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyfl
    nhwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiepg
    tdtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkraa
    ewsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmgghq
    egytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqam
    qkargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmnge
    rrirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafnd
    gfrragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlyteg
    kfdtddgkahfkpapwnglpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqeryp
    mayiemnpddckqldvtggdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdv
    ttdwtdrdiipyykgtwgdirkvgsmsefkrtvsfksrrfg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8jD (D:)
    aypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlcthmg
    cptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavgvdgl
    iygrqanvi