PDB entry 1g8g

View 1g8g on RCSB PDB site
Description: atp sulfurylase from s. cerevisiae: the binary product complex with aps
Deposited on 2000-11-17, released 2001-05-23
The last revision prior to the SCOP 1.61 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.176
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8gA (A:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstflq
    fgggryykifehnnktellsliqdfigsgsgliipdqweddkdsvvgkqnvylldtsssa
    diqlesadepishivqkvvlfledngffvf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8gB (B:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstflq
    fgggryykifehnnktellsliqdfigsgsgliipdqweddkdsvvgkqnvylldtsssa
    diqlesadepishivqkvvlfledngffvf