PDB entry 1g8f

View 1g8f on RCSB PDB site
Description: atp sulfurylase from s. cerevisiae
Deposited on 2000-11-17, released 2001-05-23
The last revision prior to the SCOP 1.63 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g8fA (A:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstflq
    fgggryykifehnnktellsliqdfigsgsgliipdqweddkdsvvgkqnvylldtsssa
    diqlesadepishivqkvvlfledngffvf