PDB entry 1g7o

View 1g7o on RCSB PDB site
Description:
Deposited on 2000-11-10, released 2001-07-20
The last revision prior to the SCOP 1.71 freeze date was dated 2001-07-20, with a file datestamp of 2001-07-20.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1g7oa1, d1g7oa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7oA (A:)
    mklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp
    esmdivhyvdkldgkplltgkrspaieewlrkvngyanklllprfaksafdefstpaark
    yfvdkkeasagnfadllahsdgliknisddlraldklivkpnavngelseddiqlfpllr
    nltlvaginwpsrvadyrdnmakqtqinllssmai