PDB entry 1g7c

View 1g7c on RCSB PDB site
Description: yeast eef1a:eef1ba in complex with gdpnp
Deposited on 2000-11-10, released 2000-12-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-06, with a file datestamp of 2000-12-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.208
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7cA (A:)
    ekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvldkl
    kaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvgef
    eagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgynp
    ktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrptdkp
    lrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqgvpg
    dnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvldcht
    ahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplgrfa
    vrdmrqtvavgviksvdkte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7cB (B:)
    paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
    dkvslddlqqsieededhvqstdiaamqkl