PDB entry 1g72

View 1g72 on RCSB PDB site
Description: catalytic mechanism of quinoprotein methanol dehydrogenase: a theoretical and x-ray crystallographic investigation
Deposited on 2000-11-08, released 2001-01-24
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-31, with a file datestamp of 2001-01-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g72a_
  • Chain 'B':
    Domains in SCOP 1.55: d1g72b_
  • Chain 'C':
    Domains in SCOP 1.55: d1g72c_
  • Chain 'D':
    Domains in SCOP 1.55: d1g72d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g72A (A:)
    dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
    igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
    kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
    fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
    aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
    vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
    pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
    gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
    atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
    tdpsaglgavgafrelqnhtqmggglmvfsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g72B (B:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g72C (C:)
    dadldkqvntagawpiatggyysqhnsplaqinksnvknvkaawsfstgvlnghegaplv
    igdmmyvhsafpnntyalnlndpgkivwqhkpkqdastkavmccdvvdrglaygagqivk
    kqanghllaldaktgkinwevevcdpkvgstltqapfvakdtvlmgcsgaelgvrgavna
    fdlktgelkwrafatgsddsvrlakdfnsanphygqfglgtktwegdawkigggtnwgwy
    aydpklnlfyygsgnpapwnetmrpgdnkwtmtiwgrdldtgmakwgyqktphdewdfag
    vnqmvltdqpvngkmtpllshidrngilytlnrengnlivaekvdpavnvfkkvdlktgt
    pvrdpefatrmdhkgtnicpsamgfhnqgvdsydpesrtlyaglnhicmdwepfmlpyra
    gqffvgatlamypgpngptkkemgqirafdlttgkakwtkwekfaawggtlytkgglvwy
    atldgylkaldnkdgkelwnfkmpsggigspmtysfkgkqyigsmygvggwpgvglvfdl
    tdpsaglgavgafrelqnhtqmggglmvfsl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g72D (D:)
    ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian