PDB entry 1g6x

View 1g6x on RCSB PDB site
Description: ultra high resolution structure of bovine pancreatic trypsin inhibitor (bpti) mutant with altered binding loop sequence
Deposited on 2000-11-08, released 2001-05-09
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 0.86 Å
R-factor: 0.107
AEROSPACI score: 1.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1g6xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g6xA (A:)
    rpdfcleppyagacrariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga