PDB entry 1g6l

View 1g6l on RCSB PDB site
Description: 1.9a crystal structure of tethered hiv-1 protease
Deposited on 2000-11-07, released 2000-11-15
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-15, with a file datestamp of .
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g6lA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnfggssgpqvtlwqrplvtikig
    gqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqydqilieicghkaigtvl
    vgptpvniigrnlltqigctlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g6lA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnfpqvtlwqrplvtikiggqlke
    alldtgaddtvleemslpgrwkpkmiggiggfikvrqydqilieicghkaigtvlvgptp
    vniigrnlltqigctlnf