PDB entry 1g5y

View 1g5y on RCSB PDB site
Description: the 2.0 angstrom resolution crystal structure of the rxralpha ligand binding domain tetramer in the presence of a non-activating retinoic acid isomer.
Deposited on 2000-11-02, released 2001-05-02
The last revision prior to the SCOP 1.63 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1g5ya_
  • Chain 'B':
    Domains in SCOP 1.63: d1g5yb_
  • Chain 'C':
    Domains in SCOP 1.63: d1g5yc_
  • Chain 'D':
    Domains in SCOP 1.63: d1g5yd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5yA (A:)
    pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
    elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
    telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
    qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5yB (B:)
    pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
    elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
    telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
    qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaph
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5yC (C:)
    pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
    elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
    telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
    qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemle
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g5yD (D:)
    pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
    elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
    telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
    qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaph