PDB entry 1g5x

View 1g5x on RCSB PDB site
Description: The Structure of Beta-Ketoacyl-[Acyl Carrier Protein] Synthase I
Class: transferase
Keywords: enzyme, gene duplication, TRANSFERASE
Deposited on 2000-11-02, released 2000-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-ketoacyl acyl carrier protein synthase I
    Species: Escherichia coli [TaxId:562]
    Gene: FABB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g5xa1, d1g5xa2
  • Chain 'B':
    Compound: beta-ketoacyl acyl carrier protein synthase I
    Species: Escherichia coli [TaxId:562]
    Gene: FABB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g5xb1, d1g5xb2
  • Chain 'C':
    Compound: beta-ketoacyl acyl carrier protein synthase I
    Species: Escherichia coli [TaxId:562]
    Gene: FABB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g5xc1, d1g5xc2
  • Chain 'D':
    Compound: beta-ketoacyl acyl carrier protein synthase I
    Species: Escherichia coli [TaxId:562]
    Gene: FABB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g5xd1, d1g5xd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g5xA (A:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5xA (A:)
    kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
    rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
    gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
    qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
    elehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgts
    tpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsini
    eeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g5xB (B:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5xB (B:)
    kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
    rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
    gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
    qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
    elehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgts
    tpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsini
    eeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g5xC (C:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5xC (C:)
    kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
    rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
    gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
    qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
    elehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgts
    tpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsini
    eeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g5xD (D:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g5xD (D:)
    kravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttglid
    rkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadamr
    gprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlgk
    qdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvve
    elehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgts
    tpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsini
    eeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrkl