PDB entry 1g5r

View 1g5r on RCSB PDB site
Description: the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form
Deposited on 2000-11-02, released 2000-11-22
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1g5ra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g5rA (A:)
  ergiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqv
  matgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisa
  lnarpghqtviitgrgchrdildladtvselrpvkha