PDB entry 1g4a

View 1g4a on RCSB PDB site
Description: crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism
Deposited on 2000-10-26, released 2001-02-21
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-21, with a file datestamp of 2001-02-21.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.257
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g4aa_
  • Chain 'B':
    Domains in SCOP 1.55: d1g4ab_
  • Chain 'C':
    Domains in SCOP 1.55: d1g4ac_
  • Chain 'D':
    Domains in SCOP 1.55: d1g4ad_
  • Chain 'E':
    Domains in SCOP 1.55: d1g4ae_
  • Chain 'F':
    Domains in SCOP 1.55: d1g4af_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g4aA (A:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g4aB (B:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g4aC (C:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g4aD (D:)
    ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
    erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
    aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1g4aE (E:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4aE (E:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrges
    sgpdvsregvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlp
    irvelqalttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnest
    enigarrlhtvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1g4aF (F:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g4aF (F:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrges
    sgpdvsregvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlp
    irvelqalttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnest
    enigarrlhtvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil