PDB entry 1g2x

View 1g2x on RCSB PDB site
Description: sequence induced trimerization of krait pla2: crystal structure of the trimeric form of krait pla2
Deposited on 2000-10-22, released 2003-06-17
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1g2xa_
  • Chain 'B':
    Domains in SCOP 1.65: d1g2xb_
  • Chain 'C':
    Domains in SCOP 1.65: d1g2xc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g2xA (A:)
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g2xB (B:)
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g2xC (C:)
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq