PDB entry 1g2n

View 1g2n on RCSB PDB site
Description: crystal structure of the ligand binding domain of the ultraspiracle protein usp, the ortholog of rxrs in insects
Class: gene regulation
Keywords: ANTIPARALLEL ALPHA-HELICAL SANDWICH, Structural Proteomics in Europe, SPINE, Structural Genomics, gene regulation
Deposited on 2000-10-20, released 2001-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.21
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ultraspiracle protein
    Species: Heliothis virescens [TaxId:7102]
    Gene: USP LOCUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g2na_
  • Heterogens: EPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g2nA (A:)
    aavqelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvv
    wardiphfsqlemedqillikgswnelllfaiawrsmeflteerdgvdgtgnrttsppql
    mclmpgmtlhrnsalqagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkgl
    knrqevevlrekmflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlva
    dtsiagyirdalrnhappidtnmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g2nA (A:)
    aavqelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvv
    wardiphfsqlemedqillikgswnelllfaiawrsmeflteettsppqlmclmpgmtlh
    rnsalqagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglknrqevevlr
    ekmflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadtsiagyird
    alrnha