PDB entry 1g2e

View 1g2e on RCSB PDB site
Description: crystal structure of hud and au-rich element of the tumor necrosis factor alpha RNA
Class: transcription/RNA
Keywords: PROTEIN-RNA COMPLEX, HuD, AU-Rich Element, TUMOR NECROSIS FACTOR, TRANSCRIPTION/RNA COMPLEX
Deposited on 2000-10-18, released 2001-02-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: paraneoplastic encephalomyelitis antigen hud
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g2ea1, d1g2ea2
  • Chain 'B':
    Compound: 5'-r(p*up*ap*up*up*up*ap*up*up*up*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2eA (A:)
    sktnlivnylpqnmtqeefrslfgsigeiescklvrdkitgqslgygfvnyidpkdaeka
    intlnglrlqtktikvsyarpssasirdanlyvsglpktmtqkeleqlfsqygriitsri
    lvdqvtgvsrgvgfirfdkrieaeeaikglngqkpsgatepitvkfa
    

  • Chain 'B':
    No sequence available.