PDB entry 1g26

View 1g26 on RCSB PDB site
Description: the solution structure of a well-folded peptide based on the 31-residue amino-terminal subdomain of human granulin a
Class: cytokine
Keywords: granulin/epithelin protein repeats, beta-hairpin stack, CYTOKINE
Deposited on 2000-10-17, released 2000-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: granulin a
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28799 (0-30)
      • engineered (0)
      • engineered (2)
      • engineered (8)
      • engineered (19)
    Domains in SCOPe 2.06: d1g26a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g26A (A:)
    vvhcdmevicpdgytccrlpsgawgccpftq