PDB entry 1g26

View 1g26 on RCSB PDB site
Description: the solution structure of a well-folded peptide based on the 31- residue amino-terminal subdomain of human granulin a
Deposited on 2000-10-17, released 2000-11-01
The last revision prior to the SCOP 1.57 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1g26a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g26A (A:)
  vvhcdmevicpdgytccrlpsgawgccpftq