PDB entry 1g1z

View 1g1z on RCSB PDB site
Description: nmr solution structures of delta-conotoxin evia from conus ermineus that selectively acts on vertebrate neuronal na+ channels, leu12- pro13 cis isomer
Deposited on 2000-10-16, released 2000-11-01
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1g1za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1zA (A:)
    ddcikpygfcslpilknglccsgacvgvcadl