PDB entry 1g1t

View 1g1t on RCSB PDB site
Description: crystal structure of e-selectin lectin/egf domains complexed with slex
Class: immune system, membrane protein
Keywords: Lectin, EGF, Adhesion molecule, SLeX, IMMUNE SYSTEM, MEMBRANE PROTEIN
Deposited on 2000-10-13, released 2001-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: e-selectin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16581 (0-156)
  Domains in SCOPe 2.06: d1g1ta1, d1g1ta2
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g1tA (A:)
  wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw
  vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcyta
  actntscsghgecvetinnytckcdpgfsglkceqiv