PDB entry 1g1t

View 1g1t on RCSB PDB site
Description: crystal structure of e-selectin lectin/egf domains complexed with slex
Class: immune system, membrane protein
Keywords: Lectin, EGF, Adhesion molecule, SLeX
Deposited on 2000-10-13, released 2001-10-13
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e-selectin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1g1ta1, d1g1ta2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1tA (A:)
    wsyntsteamtydeasaycqqrythlvaiqnkeeieylnsilsyspsyywigirkvnnvw
    vwvgtqkplteeaknwapgepnnrqkdedcveiyikrekdvgmwndercskkklalcyta
    actntscsghgecvetinnytckcdpgfsglkceqiv