PDB entry 1g1s

View 1g1s on RCSB PDB site
Description: p-selectin lectin/egf domains complexed with psgl-1 peptide
Class: immune system, membrane protein
Keywords: selectin, lectin, egf, sulphated, slex
Deposited on 2000-10-13, released 2001-10-13
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-selectin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16109 (0-157)
      • conflict (157)
    Domains in SCOP 1.75: d1g1sa1, d1g1sa2
  • Chain 'B':
    Compound: p-selectin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1g1sb1, d1g1sb2
  • Chain 'C':
    Compound: psgl-1 peptide
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14242
      • modified residue (6)
      • modified residue (9)
  • Chain 'D':
    Compound: psgl-1 peptide
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14242
      • modified residue (4)
      • modified residue (6)
      • modified residue (9)
  • Heterogens: SR, NA, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g1sA (A:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1sA (A:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g1sB (B:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1sB (B:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.