PDB entry 1g1q

View 1g1q on RCSB PDB site
Description: Crystal structure of P-selectin lectin/EGF domains
Class: immune system, membrane protein
Keywords: Lectin, EGF, Adhesion molecule
Deposited on 2000-10-13, released 2001-10-13
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-selectin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16109 (0-157)
      • conflict (157)
      • cloning artifact (158-159)
    Domains in SCOP 1.75: d1g1qa1, d1g1qa2
  • Chain 'B':
    Compound: p-selectin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16109 (0-157)
      • conflict (157)
      • cloning artifact (158-159)
    Domains in SCOP 1.75: d1g1qb1, d1g1qb2
  • Chain 'C':
    Compound: p-selectin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16109 (0-157)
      • conflict (157)
      • cloning artifact (158)
    Domains in SCOP 1.75: d1g1qc1, d1g1qc2
  • Chain 'D':
    Compound: p-selectin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16109 (0-157)
      • conflict (157)
      • cloning artifact (158-159)
    Domains in SCOP 1.75: d1g1qd1, d1g1qd2
  • Heterogens: CA, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g1qA (A:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1qA (A:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrddd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g1qB (B:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1qB (B:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrddd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g1qC (C:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1qC (C:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrdd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g1qD (D:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1qD (D:)
    wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
    twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcyta
    scqdmscskqgecletignytcscypgfygpeceyvrddd