PDB entry 1g1f

View 1g1f on RCSB PDB site
Description: crystal structure of protein tyrosine phosphatase 1b complexed with a tri-phosphorylated peptide (rdi(ptr)etd(ptr)(ptr)rk) from the insulin receptor kinase
Class: hydrolase, signaling protein
Keywords: hydrolase (phosphorylation), tyrosine phosphatase, peptide complex, hydrolase, signaling protein
Deposited on 2000-10-11, released 2001-01-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tyrosine phosphatase 1b
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (Start-297)
      • engineered (214)
    Domains in SCOPe 2.04: d1g1fa_
  • Chain 'B':
    Compound: tri-phosphorylated peptide from the insulin receptor kinase
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1G1F
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g1fA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1fA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhasagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

  • Chain 'B':
    No sequence available.