PDB entry 1g17

View 1g17 on RCSB PDB site
Description: crystal structure of sec4-guanosine-5'-(beta,gamma)-imidotriphosphate
Class: signaling protein,endocytosis/exocytosis
Keywords: G protein Rab, SIGNALING PROTEIN,ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2000-10-10, released 2000-12-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.264
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein SEC4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07560
      • conflict (55)
      • conflict (84)
    Domains in SCOPe 2.06: d1g17a_
  • Chain 'B':
    Compound: Ras-related protein SEC4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07560
      • conflict (55)
      • conflict (84)
    Domains in SCOPe 2.06: d1g17b_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g17A (A:)
    dsimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdta
    gqerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdm
    etrvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g17A (A:)
    simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag
    qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme
    trvvtadqgealakelgipfiessaknddnvneifftlakliqekids
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g17B (B:)
    dsimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdta
    gqerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdm
    etrvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g17B (B:)
    simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqiwdtag
    qerfrtittayyrgamgiilvyditdertftnikqwfktvnehandeaqlllvgnksdme
    trvvtadqgealakelgipfiessaknddnvneifftlakliqekids