PDB entry 1g12

View 1g12 on RCSB PDB site
Description: zinc peptidase from grifola frondosa
Class: hydrolase
Keywords: zinc cordinate, METALLOPROTEASE, HYDROLASE
Deposited on 2000-10-10, released 2001-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-lys metalloendopeptidase
    Species: Grifola frondosa [TaxId:5627]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g12a_
  • Heterogens: MAN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g12A (A:)
    tyngcssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhy
    tdmnsndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhess
    hftrnggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs