PDB entry 1g0u

View 1g0u on RCSB PDB site
Description: a gated channel into the proteasome core particle
Deposited on 2000-10-09, released 2000-11-06
The last revision prior to the SCOP 1.57 freeze date was dated 2000-11-06, with a file datestamp of 2000-11-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.25
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.57: d1g0u1_
  • Chain '2':
    Domains in SCOP 1.57: d1g0u2_
  • Chain 'A':
    Domains in SCOP 1.57: d1g0ua_
  • Chain 'B':
    Domains in SCOP 1.57: d1g0ub_
  • Chain 'C':
    Domains in SCOP 1.57: d1g0uc_
  • Chain 'D':
    Domains in SCOP 1.57: d1g0ud_
  • Chain 'E':
    Domains in SCOP 1.57: d1g0ue_
  • Chain 'F':
    Domains in SCOP 1.57: d1g0uf_
  • Chain 'G':
    Domains in SCOP 1.57: d1g0ug_
  • Chain 'H':
    Domains in SCOP 1.57: d1g0uh_
  • Chain 'I':
    Domains in SCOP 1.57: d1g0ui_
  • Chain 'J':
    Domains in SCOP 1.57: d1g0uj_
  • Chain 'K':
    Domains in SCOP 1.57: d1g0uk_
  • Chain 'L':
    Domains in SCOP 1.57: d1g0ul_
  • Chain 'M':
    Domains in SCOP 1.57: d1g0um_
  • Chain 'N':
    Domains in SCOP 1.57: d1g0un_
  • Chain 'O':
    Domains in SCOP 1.57: d1g0uo_
  • Chain 'P':
    Domains in SCOP 1.57: d1g0up_
  • Chain 'Q':
    Domains in SCOP 1.57: d1g0uq_
  • Chain 'R':
    Domains in SCOP 1.57: d1g0ur_
  • Chain 'S':
    Domains in SCOP 1.57: d1g0us_
  • Chain 'T':
    Domains in SCOP 1.57: d1g0ut_
  • Chain 'U':
    Domains in SCOP 1.57: d1g0uu_
  • Chain 'V':
    Domains in SCOP 1.57: d1g0uv_
  • Chain 'W':
    Domains in SCOP 1.57: d1g0uw_
  • Chain 'X':
    Domains in SCOP 1.57: d1g0ux_
  • Chain 'Y':
    Domains in SCOP 1.57: d1g0uy_
  • Chain 'Z':
    Domains in SCOP 1.57: d1g0uz_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0u1 (1:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0u2 (2:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uA (A:)
    ysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamsetlskv
    slltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqeatqs
    ggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwndele
    ledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrkltsqein
    drleal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uB (B:)
    tifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklykln
    dkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrp
    fgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddai
    elalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uC (C:)
    ralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritpskvs
    kidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytqsgg
    vrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrkepp
    atveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqeq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uD (D:)
    vstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiveid
    rhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlaaaaamsrpfgv
    alliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlkeaellv
    lkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uE (E:)
    nydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkkii
    kcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsag
    grpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikidg
    npdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uF (F:)
    gydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvk
    iqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtly
    nsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpeg
    lsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqke
    in
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uG (G:)
    drhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvsyi
    fcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytqra
    ymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkkskid
    hineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiaeqd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uH (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uI (I:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uJ (J:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uK (K:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uL (L:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uM (M:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uN (N:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uO (O:)
    ysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamsetlskv
    slltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqeatqs
    ggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwndele
    ledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrkltsqein
    drleal
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uP (P:)
    tifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklykln
    dkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrp
    fgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddai
    elalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uQ (Q:)
    ralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritpskvs
    kidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytqsgg
    vrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrkepp
    atveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqeq
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uR (R:)
    vstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiveid
    rhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlaaaaamsrpfgv
    alliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlkeaellv
    lkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uS (S:)
    nydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkkii
    kcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsag
    grpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikidg
    npdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uT (T:)
    gydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvk
    iqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtly
    nsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpeg
    lsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqke
    in
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uU (U:)
    drhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvsyi
    fcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytqra
    ymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkkskid
    hineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiaeqd
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uV (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uW (W:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uX (X:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uY (Y:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0uZ (Z:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd