PDB entry 1g0h

View 1g0h on RCSB PDB site
Description: crystal structure of mj0109 gene product inositol monophosphatase-fructose 1,6 bisphosphatase
Class: hydrolase
Keywords: HOMODIMER, COMPLEXED WITH Ca2+ AND I-1-P, HYDROLASE
Deposited on 2000-10-06, released 2001-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inositol monophosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g0ha_
  • Chain 'B':
    Compound: inositol monophosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g0hb_
  • Heterogens: CA, IPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0hA (A:)
    mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
    nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
    fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
    yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
    skemldiildll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0hB (B:)
    mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
    nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
    fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
    yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
    skemldiildll