PDB entry 1g0d

View 1g0d on RCSB PDB site
Description: crystal structure of red sea bream transglutaminase
Deposited on 2000-10-06, released 2001-05-23
The last revision prior to the SCOP 1.69 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g0dA (A:)
    masykglivdvngrshennlahrtreidrerlivrrgqpfsitlqcsdslppkhhlelvl
    hlgkrdevvikvqkehgardkwwfnqqgaqdeilltlhspanavighyrlavlvmspdgh
    iveradkisfhmlfnpwcrddmvylpdesklqeyvmnedgviymgtwdyirsipwnygqf
    edyvmdicfevldnspaalknsemdiehrsdpvyvgrtitamvnsngdrgvltgrweepy
    tdgvapyrwtgsvpilqqwskagvrpvkygqcwvfaavactvlrclgiptrpitnfasah
    dvdgnlsvdfllnerlesldsrqrsdsswnfhcwveswmsredlpegndgwqvldptpqe
    lsdgefccgpcpvaaikegnlgvkydapfvfaevnadtiywivqkdgqrrkitedhasvg
    knistksvygnhredvtlhykypegsqkerevykkagrrvtepsneiaeqgrlqlsikha
    qpvfgtdfdvivevkneggrdahaqltmlamavtynslrrgecqrktisvtvpahkahke
    vmrlhyddyvrcvsehhlirvkalldapgengpimtvaniplstpellvqvpgkavvwep
    ltayvsftnplpvplkggvftlegagllsatqihvngavapsgkvsvklsfspmrtgvrk
    llvdfdsdrlkdvkgvttvvvhkkyrslitglhtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0dA (A:)
    glivdvngrshennlahrtreidrerlivrrgqpfsitlqcsdslppkhhlelvlhlgkr
    devvikvqkehgardkwwfnqqgaqdeilltlhspanavighyrlavlvmspdghivera
    dkisfhmlfnpwcrddmvylpdesklqeyvmnedgviymgtwdyirsipwnygqfedyvm
    dicfevldnspaalknsemdiehrsdpvyvgrtitamvnsngdrgvltgrweepytdgva
    pyrwtgsvpilqqwskagvrpvkygqcwvfaavactvlrclgiptrpitnfasahdvdgn
    lsvdfllnerlesldsrqrsdsswnfhcwveswmsredlpegndgwqvldptpqelsdge
    fccgpcpvaaikegnlgvkydapfvfaevnadtiywivqkdgqrrkitedhasvgknist
    ksvygnhredvtlhykypegsqkerevykkagrrvtrlqlsikhaqpvfgtdfdvivevk
    neggrdahaqltmlamavtynslrrgecqrktisvtvpahkahkevmrlhyddyvrcvse
    hhlirvkalldapgpimtvaniplstpellvqvpgkavvwepltayvsftnplpvplkgg
    vftlegagllsatqihvngavapsgkvsvklsfspmrtgvrkllvdfdsdrlkdvkgvtt
    vvvhkk